VIP

Description

VIP is a synthetic 28-amino-acid peptide research material corresponding to the sequence of vasoactive intestinal peptide and containing a C-terminal amide modification. It is produced by controlled peptide synthesis and used in laboratory settings for analytical, biochemical, receptor-binding, and molecular investigations under defined experimental conditions. Its defined peptide structure makes it suitable for studies involving peptide characterization, receptor interaction, and molecular signaling systems. The material is commonly supplied in lyophilized form to support stability and integrity during appropriate laboratory storage and handling.

Research Applications:

VIP may be utilized in controlled laboratory research settings for applications such as:

• Analytical characterization of peptide identity, sequence, and physicochemical properties
• Investigation of peptide-receptor interactions in controlled biochemical and cell-based assay systems
• Evaluation of peptide stability and degradation profiles under defined experimental conditions
• Examination of molecular signaling and structure-activity relationships involving VIP-related peptide systems

Storage and Handling:

• Store lyophilized material at -20°C or according to batch-specific supplier documentation.
• Protect the material from excessive moisture, heat, and prolonged light exposure.
• Once prepared in solution, follow validated stability data and the specific laboratory protocol for storage conditions.
• Avoid unnecessary repeated freeze-thaw cycles and use appropriate laboratory handling procedures to minimize contamination and degradation.

Product Specifications:

• Purity: Refer to batch-specific HPLC results or Certificate of Analysis
• Appearance: Typically supplied as a white to off-white lyophilized powder; verify against batch-specific documentation
• Solubility: Dependent on concentration, pH, salt form, formulation, and solvent system; refer to supplier-specific technical documentation

Compliance Notice:

VIP is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product is supplied exclusively for controlled laboratory, analytical, and in vitro research purposes and is not intended for diagnostic, therapeutic, or clinical applications. Misuse of this product is strictly prohibited and may violate applicable federal, state, or local laws. By purchasing this product, the buyer represents and warrants that it will be used solely for legitimate laboratory research purposes.

Technical Note: The molecular formula C₁₄₇H₂₃₈N₄₄O₄₂S, molecular weight of approximately 3325.8 g/mol, and 28-amino-acid sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ correspond to the commonly referenced C-terminally amidated form of VIP. Reported analytical values may vary if a commercial preparation uses a different salt form, counterion, hydration state, terminal configuration, or formulation. Final product-page specifications should therefore match the supplier documentation and the batch-specific Certificate of Analysis (COA).